PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g064500.1
Common NameMTR_3g064500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 354aa    MW: 38839.1 Da    PI: 9.0617
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g064500.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.6e-1657101147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT eE++++++a k++G   W++I +++g  +t+ q++s+ qk+
  Medtr3g064500.1  57 RERWTDEEHKKFLEALKLYGRA-WRSIEEHVG-SKTAIQIRSHAQKF 101
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.35E-1651105IPR009057Homeodomain-like
PROSITE profilePS5129420.45852106IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-954105IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-1655104IPR006447Myb domain, plants
SMARTSM007171.7E-1256104IPR001005SANT/Myb domain
PfamPF002491.2E-1257100IPR001005SANT/Myb domain
CDDcd001671.18E-959102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MISGLEQDGL TCSSVSPAVG NVAGSHPVTH IQLSDQLSCA NDYALKARKP YTISKQRERW  60
TDEEHKKFLE ALKLYGRAWR SIEEHVGSKT AIQIRSHAQK FFSKILRDTS ASITNTKESI  120
EIPPPRPKRK PMHPYPRKLV ETVGTKEISI LKKAINSNSL KTSDFDQANQ SPKSVLSTLG  180
SESLGSSDSD TPNGSLSPIS SISCVRASVF RPAEFKTPSE EEARLDADSA PDEKPLLKLE  240
ILSDESVSAK ESIAEESSRP TLKLFGTTLI VKDFCKPSSP TIEACKPIPH DIHVRKGEGK  300
LELLGKSTLC ETSAISQLRV RVRRETCGKG FVPYKRCMSK NENQSSSATA DER*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.133464e-47flower| leaf| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1379850.0AC137985.38 Medicago truncatula clone mth2-14m10, complete sequence.
GenBankAC1518220.0AC151822.29 Medicago truncatula clone mth2-32h21, complete sequence.
GenBankCU5765360.0CU576536.3 M.truncatula DNA sequence from clone MTH2-166E15 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003600632.20.0myb transcription factor
SwissprotF4KGY63e-59RVE1_ARATH; Protein REVEILLE 1
TrEMBLG7J7Y90.0G7J7Y9_MEDTR; Myb transcription factor
STRINGGLYMA18G05050.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.11e-44MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]